DPCstruct | MC32982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7T430 | 1-91 | MKRKYASKTLGPGPTSPGQPASQALKRLLDPKKPKMACYFCRDRKIACGNPGEGALDRTCDQCRKRQLPCAYSTQSRRGIRSDKKKD… |
| A0A0C2WK91 | 420-507 | ASSESRRSRTLSPSSRNQGVLKTIMMKRGGSEPKKQNPACLFCRERKIACGRPMEGSLDQTCNQCSQRSLECRYPTESRRGQHKRLKK |
| A0A5N5QIH6 | 268-377 | None |
| A0A409WAG4 | 286-376 | None |
| A0A165V386 | 1-94 | None |
| A0A5C3KZU2 | 1-88 | None |
| A0A137QP47 | 226-323 | None |
| A0A0C2WJ48 | 206-301 | None |
| L8WIE9 | 472-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.