DPCstruct | MC32981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 280 ± 37 aa |
| Standard deviation of domain lengths | 36.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7T145 | 2-259 | ALVRATWHPTLTVYRLSLITLTTALSTAKVFTTSAASVTIDWVIGIVVFLLVFFLSYYDSDENANPRWLFRTGALEGLQTATRLILR… |
| A0A067SPQ8 | 3-282 | TVGRDEILWHPKMTPYRLLVFLTTIGFGTAKALEGRAQYVSTTLEWIGGTVVFLILFVLSPYDSGAPSPRCLAWLFEPDCMDVIWFL… |
| A0A4Y7TIE4 | 16-273 | None |
| A0A4Q2DBP4 | 548-822 | None |
| A0A0C9XA96 | 2-259 | None |
| A0A5C3LFV3 | 12-309 | None |
| A0A0C3CIU9 | 180-502 | None |
| A0A4V1Q1L9 | 18-285 | None |
| A0A409YJE5 | 21-298 | None |
| A0A067T3B7 | 3-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.