DPCstruct | MC32980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 174 ± 20 aa |
| Standard deviation of domain lengths | 19.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4BMK8 | 1-169 | MAYQLALVPTCRDISAQLVAQKRAHLTTPAEREQIRQIMRTRVDVHEAGGDAVMQDTTRGNFSSDPATTRACWPKLRLKHGKTWPAS… |
| D0P387 | 24-192 | DSSQPTVTPRRTKQPPPKAPTKRAHTLTPMECEAIRQGVKAKRDHTNQQLQEAPKQADQAMVPTLPTKPVREAWPEQWQQMQSIWPS… |
| M4B492 | 1-200 | None |
| A0A0W8CBD6 | 355-526 | None |
| K3WHA5 | 22-192 | None |
| A0A833S9I8 | 117-273 | None |
| A0A6A3IBU7 | 192-324 | None |
| A0A225W3S3 | 320-515 | None |
| A0A6A4FUY2 | 503-694 | None |
| A0A6G0KU40 | 47-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.