DPCstruct | MC3298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 247 ± 54 aa |
| Standard deviation of domain lengths | 53.60 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 17.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6L8S8 | 11-230 | IKQALQGKGNADKATAMAQLQTAVFGAAGKTLSSVEPTDLTTNSAAEGPNPLCGATATSSKAKSVIALLMCICSKTDSASGIADPCT… |
| A0A3L6L5G5 | 18-269 | ASRYIANLQLLAAEAEAALREYNSNVRPKLVKENNAITAAIKEALYGQGASKYDGTDGKTMGTLGTRNNDCKTPSAGKSIVGDLFCL… |
| A0A1G4ICB6 | 8-192 | None |
| A0A1G4IBN5 | 137-424 | None |
| A0A1G4IAE8 | 2-172 | None |
| A0A1G4IAC6 | 5-195 | None |
| A0A1G4I9R4 | 12-227 | None |
| A0A1G4I821 | 1-215 | None |
| A0A1G4I7T4 | 1-215 | None |
| A0A1G4I6W6 | 64-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.