DPCstruct | MC32978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 149 ± 24 aa |
| Standard deviation of domain lengths | 23.62 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182FPG2 | 15-121 | LREFDREAKLAAAFPKGIQCQKCLEFGHWSYECKGKRKYLHRSSRTQLLKTNLKKLHNKQASEGNGNQAAPGTTDGVTKRSGKDKKK… |
| D0P073 | 7-169 | EAPLGMWALRKEARRHMYETSTDQVRVHRRGLGSSSSSSVAAMCQKCLRRGHWTYECKNGAVYVQRPSRSQQLRNPKLRQPFNKEMP… |
| A0A445AWN1 | 50-183 | None |
| A0A1Y1L451 | 3-111 | None |
| A0A1S8W5U3 | 1-208 | None |
| U6L3H5 | 1-164 | None |
| A0A061R2M8 | 3-127 | None |
| A0A1X0S793 | 5-133 | None |
| A0A6P8ZTX3 | 1-136 | None |
| I7MIN8 | 2-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.