DPCstruct | MC32977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 144 ± 25 aa |
| Standard deviation of domain lengths | 25.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820WCV5 | 91-197 | PINIIGAEQVLLDTHSLKTVLLDLPSINLTVSRKPPQNFTKIILKNMTRAEMILKVVLTPNDFARQFVKSYLQLMNNDGDISSFQKI… |
| D0NZP8 | 1-159 | MNQVATQQLLLDVYALKTLFLQLPVLNNDGFQSSSTSTSSATIPSRYTKFVSNEMATVENVLKLIGTPNEMLVESFKIMWPEGSAED… |
| A0A2T2ZS15 | 2-168 | None |
| A0A7P0TA53 | 95-242 | None |
| A0A1I8IEJ1 | 92-221 | None |
| A0A2U1QL24 | 212-342 | None |
| T1H365 | 171-294 | None |
| A0A6A2YJE7 | 131-248 | None |
| A0A6U3CY91 | 38-169 | None |
| A0A7S2S3J8 | 588-788 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.