DPCstruct | MC32969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 107 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U1HIF9 | 1-100 | MTIEAESVRAYLTEAFLPLGIDLDTVYVTEIADVIDCDVVVSRNLVDEVLHHLRRGEEPTYDQGLFGLFHQPATFDLRYRVRGLHLL… |
| A0A2R7RAS3 | 32-127 | KVIVQDCLREAVAKIAPGVLVSKIHINVLEGGSQKANAPMGRLLEVFLECLQRGEVPVYSPAIYAIYDYPGSTDSRDIIKGLDVTAV… |
| A0A2V2AMS8 | 32-134 | None |
| J2XW15 | 190-298 | None |
| A0A1X7F423 | 12-127 | None |
| A0A486XNJ1 | 1-112 | None |
| A0A7Z2Y1H3 | 18-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.