DPCstruct | MC32962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 126 ± 16 aa |
| Standard deviation of domain lengths | 16.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7TW35 | 69-212 | MPAFAQASDLNAWKELQEHHTTLGRNIVLKEYFQKDPKRFEKFSRTFANPVDNADILFDFSKNFLTEETLSLLVKLAKEAGVEELRD… |
| A0A830R2R9 | 1-137 | MKNINPTQTAAWQALLQHFEQMKDVQIADLFAKDANRFAAFSATFDDQMLVDFSKNRITSETLEKLQALAKETDLQGAIKSMFSGEK… |
| K0TQS2 | 144-280 | None |
| A0A7S4A179 | 35-162 | None |
| A0A6S7GK68 | 5-106 | None |
| A0A287DGI2 | 4-128 | None |
| A0A0R3QPJ2 | 388-513 | None |
| A0A537BLJ3 | 151-277 | None |
| A0A816J597 | 354-478 | None |
| A0A485ATX3 | 107-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.