DPCstruct | MC3296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 417 ± 39 aa |
| Standard deviation of domain lengths | 39.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0VTF2 | 291-683 | SQDKTFWERLEIVAEAENLQPLMRAYQDLCHHFKDGAPLEKMFEYYQLINRISLEFKQLKERETRQMISAHIDQLSRIESKDSAVFE… |
| A0A5B0SM64 | 1-414 | MISQSSVFWQRLEIFAAKENLRPLMDAYRDLCHYFENGAPLNKLFEYYQLISRITLEFKEFKENETRRMLSAHIKRLSQLGKHTEGQ… |
| A0A5B0Q5E0 | 10-347 | None |
| A0A180G7A0 | 102-536 | None |
| A0A2S4VKM5 | 256-714 | None |
| H6QR16 | 126-538 | None |
| A0A5B0P1L0 | 15-381 | None |
| A0A5B0MZ19 | 266-731 | None |
| A0A5B0MMU4 | 31-444 | None |
| A0A5B0LXA1 | 175-648 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.