DPCstruct | MC32959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 316 ± 37 aa |
| Standard deviation of domain lengths | 36.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7TRQ6 | 6-315 | SVTSPEEFHFDFDWADDVEDGLQRQESHDWDLCHAAEEYLGGEDLEATSHGTSNIDFERDVEYITGADIADHDTNIVSIPSTEEVSP… |
| A0A1L9SUS4 | 1-271 | MDEEELHGYPLEAHNAELVINADILDEFWEPQKFENDKMSLQTRVWDAFSHRAEFVRYEPKQGRAVHHFNWNGDPVYEPSGTEPCIS… |
| A0A2B7X981 | 87-415 | None |
| A0A3D8QM59 | 1-220 | None |
| C1GUN2 | 303-628 | None |
| A0A1L9RQR3 | 40-351 | None |
| A0A0U5C549 | 1-336 | None |
| A0A0A2KBS2 | 348-669 | None |
| A0A5M9NCX5 | 24-341 | None |
| A0A319DY34 | 42-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.