DPCstruct | MC32957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1L7C0 | 76-145 | MDTPKLYSQDGKYLGRVSSNPVDPDSISNPVGRYGSPVSVDSVNNPVGRYGSAVSSESANNPLATNAPRI |
| A0A1G3Z4X7 | 81-173 | DTPKIYSKDGKYLGKASSNKYDPESISNTNGQYGSKYAPDSVNNPNGKYGSKYSNESVANPYATEAPKLYKNSTPANQYKAPAPYIT… |
| A0A3E0EHK3 | 126-246 | None |
| A0A6B1DM69 | 1-68 | None |
| A0A4V1S572 | 14-116 | None |
| K1Z8X1 | 120-220 | None |
| A0A1A6KRF9 | 312-421 | None |
| A0A7X9IQA5 | 39-136 | None |
| A0A1W9JIK7 | 9-75 | None |
| A0A1I4R527 | 15-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.