DPCstruct | MC32956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225ZP57 | 133-216 | PNPDLVDVAYIADEIEYIANKTSKDHVGIGSDYDGIESVPKGLEDVSKYPYLFAELIKRGWSKDDLSNLAGGNLLRAMRGMEDV |
| G0CBT6 | 22-109 | VKRATEEDFFAHLEHVLKIAGPAHVGIGMDWDGGGGVVGLEDVSDLPRITAWLLRKGYSEPQIAGIWGGNLLRVMEQAQAYAAGNRES |
| A0A195D7C9 | 187-297 | None |
| A0A226EWZ6 | 263-358 | None |
| A0A2S8FRU5 | 614-706 | None |
| A0A4C1URJ1 | 72-158 | None |
| A0A154PMK9 | 209-333 | None |
| A0A482V8U5 | 510-612 | None |
| A0A533BF96 | 44-136 | None |
| A0A226EZI4 | 125-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.