DPCstruct | MC32951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 63 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4EZ56 | 1-50 | ATSPMPKADAMNRFLKSLDMSFRRDEKSLRPRVNKLESRLDKDQKTSGNF |
| A0A7M3ZG25 | 1-60 | GGVHGKAMGPYSLRDGMNRFLNDVNVTFRRDHDSKRPRINKAESRKDREQREVGDFYSFD |
| A0A7C5XHP6 | 165-238 | None |
| A0A0D8X5V0 | 13-65 | None |
| A0A0E0M7X9 | 607-659 | None |
| A0A2H6K0D0 | 1-43 | None |
| A0A814JGL6 | 378-434 | None |
| A0A4T0R1N0 | 1076-1126 | None |
| A0A7J3DQN8 | 699-767 | None |
| A0A7J8BN44 | 13-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.