DPCstruct | MC32950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3Z5H4 | 2-148 | MNGQLALGHRLLGVNVRQVASSVVRSHFLPDLRGNLNAYGRQKVRCLKCAHSYRRMPLSGSCIQPKKETGRGLSRMGVAKAEGGLCN… |
| A0A0Q0VNY0 | 1-113 | MDEDDVAERVLTTHFIRDLMGNLNAFSRQKFRCTKCNTSYRRMPLAGKCSRCGGHIIPTVHEGSVKKYLNMSRDICEHYKVSEYTKQ… |
| A0A2U3CHF0 | 993-1107 | None |
| A0A843KJN1 | 59-185 | None |
| A0A843CJC6 | 669-794 | None |
| A0A1Q9PD80 | 150-294 | None |
| A0A7J2YGL1 | 480-603 | None |
| A0A7C2VNE7 | 695-818 | None |
| A0A7J4K9E6 | 16-141 | None |
| Q18ER3 | 2163-2289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.