DPCstruct | MC32949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5QUX1 | 1-64 | MDVRFRPPKKSDEKQWAKVRFLAEHGFFFQKVYIKKGSVWQRERYPENLEQAKEFVVQFRDQAL |
| A0A853IKH1 | 44-107 | MDIRFRPPKKLDDKQWKKVKYLVDHGFNFQKVYHKEGPIWHRERYPQNLEQAKEFVIKFKDQAY |
| A0A3L9M0X9 | 88-157 | None |
| A0A4Q5Q356 | 53-122 | None |
| A0A2P8E1M7 | 1-74 | None |
| A0A542MBR3 | 80-147 | None |
| A0A1M6WG13 | 35-96 | None |
| U9W5E0 | 5-66 | None |
| A0A7T7XQF5 | 1-58 | None |
| A0A519R960 | 13-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.