DPCstruct | MC32948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 62 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7BEK1 | 19-65 | SYFGAMYQDSQCIDGYLWDLDSGDGEYLDVGGDIPCPFCNPIDHLNY |
| A0A1V5QJF4 | 1-74 | MCDYHAPFFGATYPDACCIDGYLWDLDSCDEPGGALSVGGDIPCPACNPKAHEAYFTDVTESEEFTETCTLSDD |
| A0A2V3XE95 | 6-61 | None |
| A0A173VIT3 | 1-71 | None |
| A0A7C8F5I4 | 81-140 | None |
| A0A2X1BRK5 | 1-67 | None |
| A0A2S3XBK7 | 171-237 | None |
| V5YNR5 | 35-95 | None |
| A0A7U3CBP0 | 8-62 | None |
| A0A4V3ETX6 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.