DPCstruct | MC32944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Standard deviation of domain lengths | 15.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0HRY7 | 149-281 | ELRRDPYLSAVLAAKNLLAAKERIEARIEKTMDERDLYLPHFLGTSGAAKLLSNADETPDAKASKFFPKAARFNGSMFKAKGKQLTV… |
| A0A2A2M434 | 2-133 | AAEHASDNKSALEGSLGRDANGTDLYMAHFLGIGGAKKFLSAMANNPGASAASLFPQAAGANRSIFYASNGQPRSLSAIYQRFSDKL… |
| A0A832DLB9 | 114-240 | None |
| A0A4Q1VYN6 | 417-529 | None |
| A0A285TSA6 | 261-394 | None |
| A0A2M8VAH7 | 1-125 | None |
| A0A1W9K1V8 | 105-274 | None |
| A0A2S9Q823 | 205-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.