DPCstruct | MC32942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 619 ± 110 aa |
| Standard deviation of domain lengths | 109.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15917 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4WCJ0 | 1-526 | LVRWINDCVEFLWRLTEVHISSIVFIIVAVFIAKNLCALYVPLALLLSLALLLPSALTGVFSVIMCSFLCVVGALNMIYQVTGLVVA… |
| A0A2A2M0E5 | 15-737 | LVPAVLIFAALIRPCIISIGYLVLAFVSALLPSIVLDAPVWGSVRLFSFTSLAYTLATTVAQIAYQIYEAVTRTSDSAYTQMCNRST… |
| A0A2K3NPR9 | 36-691 | None |
| A0A044T179 | 20-680 | None |
| A0A183NSW2 | 11-662 | None |
| A0A1S3M1P2 | 164-849 | None |
| V5BWT1 | 23-823 | None |
| A0A1I8IUL1 | 56-404 | None |
| E7FD74 | 177-728 | None |
| A0A7R9AWQ2 | 42-675 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.