DPCstruct | MC32939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 150 ± 21 aa |
| Standard deviation of domain lengths | 20.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0F8V5 | 1-173 | MISKKKFLDYLGTALHEFTNFYSKIESEKAEEQFKTIYFLAQFIYSCVLDADRTDTACFEFTMSPLKHDSQKIFKTYYQTLLNQVNK… |
| R4KJP6 | 155-289 | VQFLIRFLYSCLVDADFLDTEKYACPAKSAARNNQYALGELSSKLDWFLDDMCAKAPDTVVNRWRAQILAHCREKARHASGLFTLTV… |
| A0A3B0Z0Y5 | 155-319 | None |
| A0A1X8WQ35 | 1-187 | None |
| S9S0V0 | 1-143 | None |
| A0A0Q5ZN11 | 158-283 | None |
| A0A3M2ERB7 | 112-258 | None |
| A0A0D5M5I4 | 2-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.