DPCstruct | MC32936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 141 ± 20 aa |
| Standard deviation of domain lengths | 19.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6SJX4 | 2-143 | SSQRVTFDPANLPRPENMFERRGYIDQYIQYFHSDLAPQIAEKRESSYPVVCKFYHEKRGKIEVPSVYFEYVIDKTMWKNIFKPLGD… |
| A0A395MSS8 | 9-124 | GPPPSPNFNPVDRETRKRFIKERFEHARQWNILQWEFFHKTAEYELCVKLHNADFEWVGAAFFDYLVDFASWAGYIEDRKLDHDQFC… |
| A0A366PK57 | 16-188 | None |
| S0EEX4 | 4-131 | None |
| X0AUX9 | 43-164 | None |
| A0A1B8AJF4 | 9-142 | None |
| A0A1L7VMA3 | 2-154 | None |
| A0A420NCA8 | 1-136 | None |
| A0A2H3GI29 | 4-148 | None |
| A0A2K0WB64 | 5-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.