DPCstruct | MC32935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 6.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2Q9Q7 | 7-97 | TVSDPVYFELSWSILSTIGVANVLFGAFVVSITNFSPIAAVPIVTSIAGAVANGLCYYAFYRTSQPLTNQAVASAFADILWMVQEAG… |
| W9HQ20 | 3-87 | VYYESSWSILSTIGLVNFFFAWIVIGITRLSWLSAIPAIVSAAGAVANGLCYYAWYMNSGKPRTASAYAVADILWMIQEAGLSFY |
| A0A420QKS7 | 1-90 | None |
| J3NMQ9 | 7-101 | None |
| A0A084B516 | 1-83 | None |
| F9FUW8 | 1-78 | None |
| A0A0B7K2Z4 | 2-85 | None |
| A0A4V2EPD3 | 78-171 | None |
| A0A420RQS1 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.