DPCstruct | MC32933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455SMT7 | 705-808 | LARKLREMGVLVCSCFLTDQDVQNPRQLLHEAPAEWSKEAQLMFHLASPLPENTRLEDLLIHHNWTIHPQPQLFVQINHSEVLREFH… |
| A0A559LGC5 | 1-127 | MGIHYHPFKDLQAMNVTVATIFLTNQTVEAPKSLYDEHMLHWDKGHLTLFDVSTPVHGSAHPIPFLASTGWRIPSSGDCRLYTAVCS… |
| X0I4H1 | 1-113 | None |
| A0A166WZR1 | 321-451 | None |
| A0A3D8QZS0 | 311-435 | None |
| A0A084AR28 | 363-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.