DPCstruct | MC32932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532F124 | 1-79 | MARAFTGKTKNDQLANYTVSPAAQHESTCTRCGGFMVNDSYLNLLNNIGESKFSAKRCVQCGDVVDSVVLLNRQSRQSQ |
| A0A1W1HV41 | 1-65 | METHGTPESLSTPQPEHHICPRCGGLLLTQHYIDLLDDTGQIDITAWHCTMCGEVLDPVILKNRR |
| A0A4P5WN76 | 1-78 | None |
| A0A1F9D8L8 | 24-104 | None |
| A0A357ELT4 | 1-77 | None |
| A0A533YUP8 | 7-85 | None |
| A0A1W1I1Z3 | 1-87 | None |
| A0A7Y4YKE6 | 53-131 | None |
| A0A538RQZ5 | 23-103 | None |
| A0A0S4L4E9 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.