DPCstruct | MC32931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 201 ± 23 aa |
| Standard deviation of domain lengths | 22.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532ESZ7 | 23-233 | GYRPGMTPEQYFDHLCKTEAGEFIYKTVENVDGLYMMRPREQVFDDHMQHLYALEDPYGYTDWEARDSQTVFVDPPWRVYSYLEMPL… |
| A0A3S2Y007 | 42-277 | ATDAAYREKLAKAQAIFAERCKSAGVVIHRTVKDVEGIELKRIRPKLEFGDKRYFDPMFEGAAMAGEQGGVDYIKQFLMYEFRSPDR… |
| A0A286ECU7 | 82-296 | None |
| A0A7X9JSX3 | 17-219 | None |
| A0A4S3MMF4 | 60-215 | None |
| A0A434CQZ9 | 87-273 | None |
| A0A257CC52 | 466-676 | None |
| A0A1H0WTN1 | 270-454 | None |
| A0A5C7T2B3 | 179-395 | None |
| A0A5K5DT46 | 1-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.