DPCstruct | MC3293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 369 ± 41 aa |
| Standard deviation of domain lengths | 40.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023- CL0097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0S608 | 41-398 | DSGAQNGAALRQMLLERDNRPYPAYRDTEGSWKFDRFRLGVMRIQSDPFAPPTRLKINLSDDQHRWPQHLRASPIRRAALADWLTRR… |
| L1QJ18 | 2-355 | KNSNDLKRELDRIDGRGYKSYKDLEGQYDFDKFILSIDHVQGDPFAAPSRIRVIVKNNINKFPIELFKEGYKRVALCDFLTRLFTKN… |
| C1N3B2 | 16-434 | None |
| A0A3P3YL31 | 443-838 | None |
| A0A4S4LTR3 | 67-476 | None |
| A0A7C7R1T3 | 15-325 | None |
| A0A507DS74 | 25-440 | None |
| B7FSL8 | 64-465 | None |
| A0A3G2S4T8 | 2-334 | None |
| A0A150VBR1 | 1-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.