DPCstruct | MC32928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 11.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532EJI4 | 93-192 | SSEEQFMHYIRQVRVDYPGTANEHISQLRSSSHPSGSLVSESREQVVRNIDSGRESYRSHNDATGDEARVETRTSSRGTRYVATVAD… |
| A0A4R7G310 | 4-102 | KWANYLISQVKYNEQHTHIIDVVVHEDLGNAVGDAVIQPRQWVISMIDNDYSFCTAIQNNHGKWVRGRIVVTDRVMGKDYLTTLADG… |
| A0A7V8Z4I5 | 3-88 | None |
| A0A3L8C268 | 522-628 | None |
| A0A1P8KB09 | 65-199 | None |
| A0A3N5FQN6 | 1-117 | None |
| A0A7K4NRB7 | 1-102 | None |
| A0A3M9ZYF8 | 4-101 | None |
| H2CA15 | 7-96 | None |
| A0A2U2AQP7 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.