DPCstruct | MC3292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Standard deviation of domain lengths | 12.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6LXU3 | 1-88 | MSTLEFLVEEAKGLRKDLGLYLFNFDMIRYGEGDGYLVIDMNYFPGYEKFPSYETVMIDFFLNVMKLQELENMKKKEIDDRWKFGNQK |
| A0A7S2VCZ9 | 91-179 | IVTAEEVGPIVNALKSAFGLEIFGFDILITSGDASEQSMLVVDVNYFPSYKEVPNFPALLAEYLTRKAIARRVEVSDAKKSDDCHKG… |
| J3LCR8 | 1-89 | None |
| A0A6S7MFN1 | 20-113 | None |
| A0A5N5IZI5 | 24-93 | None |
| A0A7J0ECI0 | 176-271 | None |
| A0A5J5AWZ5 | 123-232 | None |
| A0A6S7PHT5 | 83-161 | None |
| A0A445LXG9 | 175-254 | None |
| A0A7S0FGY3 | 81-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.