DPCstruct | MC32918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 213 ± 52 aa |
| Standard deviation of domain lengths | 51.75 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1GGF2 | 60-268 | KGKKKGKKKEPNLDAVRETAIEEAARVSAEDFEDRLEYTCLSVHRYLCRGTVRYIAALRQAGLLSEPPSSITMFTSHQTRFEKRFDS… |
| A0A2P7YTQ4 | 642-989 | KMLSNYGNNKCRQRQFDNQTIVIWDTLQYTSENLELYLFSKFAIGDRLAPDSMEPALPVTAFAYHTKLNVMLETILSGFELNLYKPF… |
| A0A182EG08 | 37-278 | None |
| B3MDN8 | 38-236 | None |
| A0A7S2SAQ4 | 57-308 | None |
| A0A7S3BLR1 | 6-175 | None |
| A0A194Q2B3 | 761-963 | None |
| A0A6V7U7H8 | 84-328 | None |
| A0A7S2RN56 | 155-382 | None |
| A0A812M117 | 523-687 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.