DPCstruct | MC32917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1GFX0 | 1-101 | DFQDVAGLNQLDPNFVGMIDQVVCSRGRVFVGTYFSSFSAYIGRMRGYHGTSNKLMFYGQRDRKYETHTWFYPHSSYSAREYPTGWN… |
| A0A7S3H488 | 74-163 | DFMDFADLKNINPNFLGMIDQVVCTRGDIFVGTWFSTFTGYITRMRGYMGYSDKTTFFGDLAHRDRYQQFEQPKFPFYMREWNTSWH… |
| K0RBB8 | 545-639 | None |
| A0A7S2AIN4 | 42-140 | None |
| A0A7S2YL06 | 1-119 | None |
| A0A7S0AB18 | 199-292 | None |
| A0A7S3HJP3 | 48-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.