DPCstruct | MC32915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0TDC7 | 10-110 | AITQQEVVEKIEGGKITDRSTLVLEGEDLKVKNLDLDGALVIRTGHDCDVTVDGLVVRNTGYDLSEVPEGADVPEEVAIRGYTMNKS… |
| A0A7S4B5V2 | 113-230 | PQLVLSPAFRSTVSSAMHKLGGAQIKITARSSLVLDGEDIKVEQLDLDGAARISCVLGASVTIRKLTVHNKGRVLRELSQEEMASPA… |
| A0A7S2VZ10 | 115-228 | None |
| A0A7S1NMY0 | 6-98 | None |
| A0A7R9U0J4 | 6-112 | None |
| A0A7S0AC80 | 8-107 | None |
| A0A2V2VGC4 | 357-492 | None |
| S9TW13 | 415-569 | None |
| A0A7S3PEA8 | 229-344 | None |
| A0A448ZEF2 | 578-700 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.