DPCstruct | MC32912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 14.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 13.28 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF07600- CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A268IWP9 | 10-108 | IQKTDESRVKFRTNISKAVLNQLEPLSAEHDTHINYLLESGLQEVLNHDFITYDKKTRPKDRVQYKTTYDKVLLEQVKDFANNHGLF… |
| A0A1I5FT81 | 5-121 | PTGRPSKGPRAVVLPRVLLADDRALKALAAARGWYVSETAAKLINVGLQHAAELPDDLPRRVAATESTDFTARIPLSDNTLLRSIAS… |
| A6GUS5 | 1-110 | None |
| S3URY5 | 22-145 | None |
| A0A164QBW7 | 124-215 | None |
| A0A362XEY5 | 3-104 | None |
| A0A6G6J857 | 3-133 | None |
| M6VZS0 | 13-138 | None |
| A0A556ULN2 | 109-221 | None |
| M3EBE9 | 78-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.