DPCstruct | MC32910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U8UEY0 | 1-148 | MKYLREKDINGFIMTTKTPINETSSGEEQYKGIALYARKKLCQEPSFFSVGTDKSHAFSYMYGEINVDFIDEDADNIATYGGNVVWN… |
| A0A0B5EBE5 | 58-169 | LDIKGFVASVKKPANLKITGTDERATIDLFVNGRLREKNIIRHIPSQRIVESYIYGQIHFDTLDREGTDPFTSSREGIVEDDEKFRS… |
| W9TT09 | 40-156 | None |
| A0A1C3SUE5 | 254-349 | None |
| A0A0N1JF08 | 191-335 | None |
| A0A074TKH7 | 62-154 | None |
| A0A119DLD1 | 62-164 | None |
| A0A811TFX4 | 47-154 | None |
| A0A2E0HKN3 | 238-363 | None |
| I0SEX0 | 90-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.