DPCstruct | MC3291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 54.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0296 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6LVA7 | 17-107 | VKAGDVVVYTKHTGEALKYDGEDCVLLSSEELLAKVSEPEPLQAADVQPLGDTVFVRVLKPSDRTAGGLLLVPQQQQRLLQQAEVVA… |
| A0A2J6LVJ6 | 24-89 | CPVVYSKYAGSEVEFNGSHHLILKEDDIVGILETEDVTDLKPIDDKVPIKGEEAEETTAGGLLLTQ |
| A0A2J6M690 | 976-1053 | None |
| D7FNY7 | 20-114 | None |
| A0A830CA97 | 4-81 | None |
| A0A835HIM1 | 4-80 | None |
| A0A445DND4 | 1059-1136 | None |
| A0A822Z416 | 32-101 | None |
| A0A7R9TJ97 | 317-420 | None |
| A0A0N7KLP9 | 20-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.