DPCstruct | MC32909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 145 ± 27 aa |
| Standard deviation of domain lengths | 27.16 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 15.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14301 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U8UCZ6 | 14-153 | FEDDFLEIPPHLTPLSEEEVNAILSPSPEEALEIAKATKKVEMNAKRDEAIEQDIEFNGEIFTNRKSDRDIISSYLSLSLPENFAWI… |
| A0A417HJB9 | 24-143 | QDWNDVEQVRTAKKAEIGLACSAAIYAGIDVGGAHYSLTEHDQTELMAQFQTVKEGAEEVPYHADGELCRMYTAEEFTALAQAATAH… |
| A0A3S4CJB6 | 6-119 | None |
| A0A168UY01 | 14-158 | None |
| A0A127CIZ4 | 78-215 | None |
| A0A1W9JIM2 | 3-100 | None |
| A0A1S1MWJ5 | 163-260 | None |
| A0A559KCY5 | 178-328 | None |
| A0A2E9IVA8 | 158-297 | None |
| A0A3S4HXI3 | 16-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.