DPCstruct | MC32907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 250 ± 27 aa |
| Standard deviation of domain lengths | 27.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0357- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4UH28 | 263-481 | ESDRLICACECKGSIKYVHVECLRKWIDSKWSLRGEDPLPSIVFIKEVSCELCKTNYPCFIRQNGELIQIVKMPKMQTPFLVLENTT… |
| A0A7J6S2X3 | 19-270 | GMPCRICLLEASGSDEDPLVEACACRGSIRYVHLGCLRHWVEGRLSLNSGPEQQGPAHTYLFRQLACELCRTNYPLYVKLHDGHVEQ… |
| A0A812IB41 | 2-243 | None |
| A0A1R2CM88 | 171-411 | None |
| G5A1T1 | 197-467 | None |
| A0A2T7IA16 | 295-513 | None |
| G0QZB3 | 208-515 | None |
| A0A812T847 | 617-845 | None |
| A0A812PND4 | 404-675 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.