DPCstruct | MC329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 4.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183GUW1 | 2-47 | WRKNVDRDVEGAEACTICMMTIHSTNHQLPKVKCRQCKNKFHSNCL |
| A0A060Z6F1 | 1-55 | MEGLALWKTNVDKRFEGVEDCMICFSVIHGSNYSLPKKACRTCKKKFHSACLVRD |
| E9GKJ1 | 137-188 | None |
| A0A1D6EIE2 | 1838-1890 | None |
| A0A183HJ25 | 54-107 | None |
| A0A1W0E8G3 | 1162-1229 | None |
| A0A7R8X6H0 | 289-340 | None |
| A0A453MLB8 | 88-143 | None |
| A0A7R9D7N3 | 187-238 | None |
| A0A817ZUE6 | 167-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.