DPCstruct | MC32897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 173 ± 24 aa |
| Standard deviation of domain lengths | 24.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8X7D6 | 1-190 | MTLTAMEKFPNNRQLQKNCFLTLCSDTLLYRATFNCNQCCELVFNNLIAFDDMHMKRMGVAIISILAAEITTAGLSELARDRRRIQC… |
| A0A0K2UMX6 | 322-485 | MEAFPQHKQLQKNVLLTICCDRILTEVNFDKYRCARLAMDCLCEWDDTSMNRMSVAICSILAAKITTTQTSELGSQPNYMKKLLSIV… |
| A0A654HIU9 | 19-193 | None |
| A0A310SIZ1 | 407-568 | None |
| A0A183UEG0 | 1-163 | None |
| A0A0K8R977 | 1-168 | None |
| A0A672Q920 | 252-394 | None |
| A0A5K4F7I7 | 353-547 | None |
| A0A3P7NLS8 | 55-218 | None |
| A0A1I7UR00 | 441-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.