DPCstruct | MC32896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 133 ± 11 aa |
| Standard deviation of domain lengths | 11.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6QD44 | 177-293 | HNHVPLLHVRKACVEDHDDLTPIFKQLNNNLTETYGDYFLAEMIEAQDEDNHSIVAEVGGKAVGFLSVCSHVNVKLLQDCFELDSFH… |
| A0A6V7HFE1 | 4-133 | LAKSKFRFLRDREEDNDDVVTIIDAETSMVKEFYGEFYVSEIVRHPDNCRRLIVSEDDEGLATGVMFLNSNIDVDTLNENFELVPYN… |
| A0A6J3BZN0 | 96-236 | None |
| A0A833R558 | 18-155 | None |
| A0A0J9U8N5 | 186-305 | None |
| A0A3P7P1V0 | 29-159 | None |
| A0A6P3YDD2 | 27-156 | None |
| A0A6J3C3M4 | 103-229 | None |
| A0A813T9D4 | 191-324 | None |
| A0A7J7K6N3 | 178-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.