DPCstruct | MC32889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 484 |
|---|---|
| Mean domain length (aa) | 231 ± 58 aa |
| Standard deviation of domain lengths | 57.93 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 99.40 |
| Assigned Pfam label(s) | CL0268- CL0123- PF14111- CL0617- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5VML3 | 3-162 | GPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLL… |
| A0A5N6NY16 | 23-250 | KDAPPNLTLRAQAFVIIENLRRLVHKDCGHVVSCSDITTLAARDAVVMSGGPDYSVPLGRRDGLTFATRNVTLANLPPPFAKTNAIL… |
| A0A813ASM5 | 3-157 | None |
| A0A835H0C6 | 11-216 | None |
| A0A835XIZ7 | 36-319 | None |
| A0A5P1FEQ6 | 39-308 | None |
| A0A1R3HTG2 | 24-225 | None |
| A0A835JS18 | 282-463 | None |
| A0A446Q951 | 2-134 | None |
| A0A7S4R4Z0 | 141-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.