DPCstruct | MC32888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 19.92 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.71 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | CL0020- CL0050 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6NPL7 | 115-243 | IKSNEDNLVVSTDVMMALETALQCQFVRHFQELYGKSKYEEAVDLAVESPQGILRTPDTLAMLHNIPVQAGQTPPLLQYYGALLKKG… |
| K1VYA0 | 2-120 | IMEQYQRYLQSAQYNEAAKIAANSPRGILRTPQTIETFKSLPNVPGSLSPILQYFGILLEKGELNKYESLELARPVIQQGKKQLLEK… |
| A0A177SXQ1 | 10-127 | None |
| A0A177T0C8 | 79-201 | None |
| A0A815YHH0 | 63-186 | None |
| A0A815TR44 | 24-200 | None |
| G0QMD9 | 101-238 | None |
| A0A0E0BMM1 | 101-234 | None |
| A0A426Y078 | 34-172 | None |
| A0A819NSB9 | 158-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.