DPCstruct | MC32887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 162 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 99.00 |
| Assigned Pfam label(s) | CL0209- CL0648 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7KAT9 | 13-156 | SKEHFLEERNYNKWAESYIKYNLSNLKIEKEDLTIYFDNLQVSGNACVSIRKGKQINSFEYIIKFEWLYSKKKEGKDYFGGSVEIPD… |
| A0A5N6NKJ0 | 20-180 | ANVHNWHWSETDCLEWSKNLLSKLLADQTIVAGEQNFFIKTKKIEKVEGEAYVNVRKGKIIPGYELSVSINWQGEEKDSDGKSVFVA… |
| A0A7S4HEU1 | 4-163 | None |
| A0A482VZ29 | 14-165 | None |
| A0A226EVA1 | 8-173 | None |
| A0A6A6LLP1 | 7-145 | None |
| A0A7S2UQL1 | 112-273 | None |
| K8E9C2 | 38-234 | None |
| A0A7S2S267 | 15-231 | None |
| A0A7S2JPG0 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.