DPCstruct | MC32884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 66.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6NDB2 | 16-92 | LRVDVTKIRECVGDTEAYVQNKVLKGKGARGDVTMLPTLKINNRQYRGKLDKGTVLKAICSGFEETTEPVICLRDGQ |
| A0A287NIM4 | 80-162 | IKSLGLDHKAIDKCIGDPDADEENPILKAEQDAQIGKGSRGDVTILPTLVINNRQYRGKLDKGAILKALCAGFRETTEPTVCL |
| A0A1R3G773 | 784-887 | None |
| A0A452Y7S0 | 118-202 | None |
| A0A453HPC7 | 405-501 | None |
| A0A0E0R3F3 | 318-413 | None |
| A0A287R1X6 | 45-127 | None |
| A0A287H7Z3 | 2-74 | None |
| A0A2P5W074 | 54-146 | None |
| A0A078F916 | 4-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.