DPCstruct | MC32880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 208 ± 23 aa |
| Standard deviation of domain lengths | 23.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M6WAT3 | 1-248 | MDISPPDFQGKNNSFKKGLEDKADFTLANNLADKDVLYNDDYNDDNKNKKSISPKVVFSALVIVALGTLFYGFISLSAKIYSGANLQ… |
| A0A2M7XB66 | 1-214 | MAIKRIGNRPRSPLGAEQKIAFALLMFLGVGGVFFGFKSFGANLMRPIQTQIADLYTGETFLTTGEREAEALEESKTKDTDGDGLVD… |
| A0A2M7Z8E1 | 1-198 | None |
| A0A554JJ15 | 1-174 | None |
| A0A2M6W105 | 6-207 | None |
| A0A1W9QMC8 | 2-180 | None |
| A0A0G0YEV1 | 2-216 | None |
| A0A1G1YQ52 | 1-218 | None |
| A0A2H0V124 | 1-244 | None |
| A0A1F6M2Q6 | 47-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.