DPCstruct | MC3288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 3.96 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 68.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6LUQ1 | 3-68 | IDKVVWALRNVAGDSPKCRDFVLAQGALIPLLFQLNEHAKLSILRNATWKLPNFCRGKPQPSFSQM |
| A0A1S8ABS5 | 300-368 | ASPSEDVREQAVWAMGNIGGDSLGCRNLVLREEALIPVLEQLKDHTKLSMLRTATWTLSNLCRGMPQPP |
| A0A426ZT08 | 123-187 | None |
| A0A2U1PTF0 | 101-175 | None |
| A0A396I758 | 58-129 | None |
| A0A0D9V0J8 | 300-358 | None |
| A0A446INR7 | 77-140 | None |
| A0A4S4D0A0 | 639-708 | None |
| A0A5D3DG57 | 174-236 | None |
| A0A540KP07 | 68-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.