DPCstruct | MC32877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 538 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A8E8F2 | 300-838 | TAVQILDYSLAGHVNLEADIQLPEPDGIVQIETFGVSINANGACFYGLQLEAVMDRVKDAISLDHLSRLLVDVQTDSSEIVEPLLSP… |
| A0A7S1MYJ3 | 1-551 | EGGRGGVRSQSRLVDCLGSVSVNFQANLCAMDGGELPGVRKVEHFGVHVGVERGVVVGAQMESVMDRDWDDMSFEMLARVLVDLHTN… |
| A0A2P4YSF6 | 1-520 | None |
| A0A7S2RBC2 | 295-835 | None |
| A0A7S3BFQ2 | 634-1159 | None |
| L1IIY2 | 421-967 | None |
| A0A3R7KN00 | 68-599 | None |
| A0A6H5KP39 | 11-538 | None |
| A0A1Y5I9U1 | 266-813 | None |
| A0A662Y2J2 | 29-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.