DPCstruct | MC32874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 297 ± 43 aa |
| Standard deviation of domain lengths | 42.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0RQT5 | 312-576 | DWMKLLEKLAQNNILTNENKQVIADNAKHAKKITNALITLAKGNILTNENREFITKHPEYADIVSNALILLAQENILTSINGRFIVD… |
| A0A0W0TKV3 | 269-558 | ASPETGNKLLAHREVLENQKPDVMEKVLAVFQMREWKIADYLDYLFAINEVGLQFTVTHMAKLPLETGYLTRVLDALKVEGAHYRTI… |
| A0A0W0RKZ9 | 16-254 | None |
| A0A1F8J3S3 | 81-346 | None |
| A0A0S7XZV3 | 3-328 | None |
| A0A0S7XYZ1 | 11-285 | None |
| A0A0S7XY13 | 2-273 | None |
| A0A0W0XL57 | 226-583 | None |
| A0A0W1A089 | 1-321 | None |
| A0A2H9T0C6 | 2-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.