DPCstruct | MC32873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 143 ± 19 aa |
| Standard deviation of domain lengths | 19.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1D442 | 12-146 | KKTVAIITSSFLGTFFISRLFVYLVLGHLAPNFFLTIRGVHIHHFTYGFIILAITGIYLLIKHPAPGSHLFKWLAWFYGIGLGLSTD… |
| A0A7J2GYS3 | 20-133 | SLRRRWATFLVWSSALIGFLVSRIFVILFPETHLIIFGYHIHHFYYGLVLILLAGAISITYRGLLLVRLSCVLYGLGLGILIDELGL… |
| A0A2W0A284 | 39-188 | None |
| A0A146G3R7 | 11-174 | None |
| A0A538TCG5 | 24-187 | None |
| A0A4P7RH00 | 15-138 | None |
| A0A6J4NGN3 | 14-192 | None |
| A0A1R0UG77 | 9-165 | None |
| A0A2H0UQA8 | 11-156 | None |
| A0A7Y2W2U3 | 15-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.