DPCstruct | MC32872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 239 ± 26 aa |
| Standard deviation of domain lengths | 26.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 13.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A0CEZ1 | 333-569 | WPLWIFLSILPVAAVVEKPHSGYMCAVGFAVAMALAPVAVRFTRSKWLTAATLSLVSILFLGVAFMTPVNRLQWLGIAAAERYTPSW… |
| A0A0G1A6D1 | 12-254 | QEKKLYLFSILFFIIALGPVYNLQLSGFTSEGERFVYLPSIGMAMLLAVIVAGLWKKWRILGIITAMVLIVYFSFNLWQRNLIWQNA… |
| A0A388Q6X0 | 2-219 | None |
| A0A7X7J1V6 | 321-572 | None |
| A0A2E9R4S6 | 406-715 | None |
| A0A2V5QXB9 | 275-502 | None |
| A0A2E6ENX1 | 261-562 | None |
| A0A143PVS8 | 8-215 | None |
| A0A522A3E9 | 143-382 | None |
| A0A3N5EIS4 | 54-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.