DPCstruct | MC3287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4141 |
|---|---|
| Mean domain length (aa) | 158 ± 31 aa |
| Standard deviation of domain lengths | 31.49 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 12.39 |
| Pfam Score | 82.05 |
| Assigned Pfam label(s) | CL0258- PF01412- CL0020- PF16172- PF12394 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6LML7 | 2-139 | ATLEVKLIQAHALTNKDLIGKSDPYAKMYIGPERGKTQSSKVIDNDLNPIWNEHFEFVVEDTSTQHLAVEIYDDDGLQASEVIGYAR… |
| A0A7S2E3C9 | 5-144 | GTVVSIRIEKIGLKDAQEYIDPFMTVLVADPRTNLLDTHDTPKAKELRATHVIFDHQVYLNISLEDMQRQGAALFFEFKHYKPKKKK… |
| A0A3Q4HPX4 | 157-314 | None |
| A0A6D2HFZ3 | 352-496 | None |
| R5FY43 | 373-555 | None |
| A0A6P8IED0 | 351-550 | None |
| A0A6P8IAP4 | 695-877 | None |
| A0A6P8I8D7 | 303-509 | None |
| A0A1A7Y9B4 | 188-367 | None |
| A0A0D3CSU0 | 6-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.