DPCstruct | MC32869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 14.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.70 |
| Pfam Score | 92.66 |
| Assigned Pfam label(s) | CL0023- PF06155- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538B0E9 | 1-73 | MVSRFGLEELRANCPCAECRGLRDQGAAVWPKPTSPQPLRAEGAELVGAWGVSLRWNDGHSTGIYAWDVLRAW |
| A0A7Z9H5W9 | 12-122 | RRLPQDERTQLQELEVLHPDTLLLVWKDGHETLYRHRALRESCACAACVDEWSSKAILDPATLPEDLTILRCDRTGRYGLNIAFSDG… |
| A0A2V5HRI0 | 262-357 | None |
| A0A182FHS4 | 337-431 | None |
| A0A6P8HEE9 | 337-453 | None |
| A0A168DB23 | 458-580 | None |
| A0A3L7PBD6 | 3-98 | None |
| A0A0D9VDD2 | 19-118 | None |
| W4GS42 | 30-142 | None |
| A0A517SN37 | 4-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.